PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009613402.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 367aa    MW: 39966.8 Da    PI: 6.5082
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009613402.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.31e-30227282359
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     DgynWrKYGqK+vk se+prsYY+Ct+ +Cpvkkkve s  d++++eitY+g+Hnhe
  XP_009613402.1 227 DGYNWRKYGQKMVKASECPRSYYKCTHLKCPVKKKVELSI-DGHITEITYKGHHNHE 282
                     9***************************************.***************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.7E-27221284IPR003657WRKY domain
SuperFamilySSF1182902.48E-24224284IPR003657WRKY domain
SMARTSM007742.5E-32225283IPR003657WRKY domain
PfamPF031061.1E-22227282IPR003657WRKY domain
PROSITE profilePS5081121.631227284IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MGEKFKASAV SELTIPPRAP SFEAFFGGGN MPYFSPGPMT LVSSFFSESE YPSFSQLLAG  60
AMASPLAKPP TLFPENSSGE ENCKEGNQKN LGYKQNRPMS LMVAQNSPLF MIPTGLSPSG  120
LLNSPGFLSP LQSPFGMSHQ QALAHVTAQA ALSHSYLQTQ AEYHFSSQGT SAQVLGNETS  180
TEPTESSLRP QLNAMPSDQQ SKKIELPLVS QSEDKPSFAS VDRPACDGYN WRKYGQKMVK  240
ASECPRSYYK CTHLKCPVKK KVELSIDGHI TEITYKGHHN HELPQPSKRR RDSCAQDGSD  300
CSKAKPESEM QSGTEVNGLN GALPARSGQM STEMASGLLL SNECDKIEDT ATAAEERHDD  360
EPNVKRM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-142272841674WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7111350.0AB711135.1 Nicotiana benthamiana NbWRKY14 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009613402.10.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9XI902e-72WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLA0A0P0UVQ80.0A0A0P0UVQ8_NICBE; Transcription factor
STRINGPGSC0003DMT4000142200.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43142344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.19e-67WRKY DNA-binding protein 4